Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (21 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Homeotic bicoid protein [140155] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140156] (1 PDB entry) Uniprot P09081 97-163 |
Domain d1zq3p1: 1zq3 P:2-68 [125499] Other proteins in same PDB: d1zq3p2 protein/DNA complex |
PDB Entry: 1zq3 (more details)
SCOPe Domain Sequences for d1zq3p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} prrtrttftssqiaeleqhflqgryltaprladlsaklalgtaqvkiwfknrrrrhkiqs dqhkdqs
Timeline for d1zq3p1: