SCOPe 2.08: Domain d1zq3p1: 1zq3 P:2-68

Lineage for d1zq3p1 (1zq3 P:2-68)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.1: Homeodomain [46690] (41 proteins)
   Pfam PF00046

6. Protein Homeotic bicoid protein [140155] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140156] (1 PDB entry)
   Uniprot P09081 97-163

8. Domain d1zq3p1: 1zq3 P:2-68 [125499]
   Other proteins in same PDB: d1zq3p2
   protein/DNA complex

Details for d1zq3p1

PDB Entry: 1zq3

PDB Description: nmr solution structure of the bicoid homeodomain bound to the consensus dna binding site taatcc

PDB Compounds: (P:) Homeotic bicoid protein

SCOPe Domain Sequences for d1zq3p1:

Sequence; same for both SEQRES and ATOM records:

>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
prrtrttftssqiaeleqhflqgryltaprladlsaklalgtaqvkiwfknrrrrhkiqs
dqhkdqs

Timeline for d1zq3p1:

• d1zq3p1 first appeared in SCOP 1.73
  
• d1zq3p1 appears in SCOPe 2.07