Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (24 families) |
Family b.82.1.16: YML079-like [117318] (3 proteins) Pfam PF06172; DUF985 |
Protein Hypothetical protein Atu3615 [141605] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [141606] (1 PDB entry) Uniprot Q8U9W0 4-143 |
Domain d1znpe1: 1znp E:5-143 [125398] automatically matched to 1ZNP A:4-143 |
PDB Entry: 1znp (more details), 2.5 Å
SCOP Domain Sequences for d1znpe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1znpe1 b.82.1.16 (E:5-143) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]} msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv spgfafssfvmaepgwspg
Timeline for d1znpe1: