Lineage for d1znpd1 (1znp D:5-142)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 809734Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 809735Superfamily b.82.1: RmlC-like cupins [51182] (24 families) (S)
  5. 810095Family b.82.1.16: YML079-like [117318] (3 proteins)
    Pfam PF06172; DUF985
  6. 810096Protein Hypothetical protein Atu3615 [141605] (1 species)
  7. 810097Species Agrobacterium tumefaciens [TaxId:358] [141606] (1 PDB entry)
    Uniprot Q8U9W0 4-143
  8. 810101Domain d1znpd1: 1znp D:5-142 [125397]
    automatically matched to 1ZNP A:4-143

Details for d1znpd1

PDB Entry: 1znp (more details), 2.5 Å

PDB Description: X-Ray Crystal Structure of Protein Q8U9W0 from Agrobacterium tumefaciens. Northeast Structural Genomics Consortium Target AtR55.
PDB Compounds: (D:) hypothetical protein Atu3615

SCOP Domain Sequences for d1znpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1znpd1 b.82.1.16 (D:5-142) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]}
msaqaiirelglephpeggfyhqtfrdkaggerghstaiyyllekgvrshwhrvtdavev
whyyagapialhlsqdgrevqtftlgpailegerpqvivpancwqsaeslgdftlvgctv
spgfafssfvmaepgwsp

SCOP Domain Coordinates for d1znpd1:

Click to download the PDB-style file with coordinates for d1znpd1.
(The format of our PDB-style files is described here.)

Timeline for d1znpd1: