SCOPe 2.01: Domain d1zlxa_: 1zlx A:

Lineage for d1zlxa_ (1zlx A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.1: Formyltransferase [53329] (4 proteins)

6. Protein Glycinamide ribonucleotide transformylase, GART [53330] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82468] (12 PDB entries)

8. Domain d1zlxa_: 1zlx A: [125270]
   automated match to d1meoa_
   complexed with gol

Details for d1zlxa_

PDB Entry: 1zlx, 2.2 Å

PDB Description: The apo structure of human glycinamide ribonucleotide transformylase

PDB Compounds: (A:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d1zlxa_:

Sequence; same for both SEQRES and ATOM records:

>d1zlxa_ c.65.1.1 (A:) Glycinamide ribonucleotide transformylase, GART {Human (Homo sapiens) [TaxId: 9606]}
arvavlisgtgsnlqalidstrepnssaqidivisnkaavagldkaeragiptrvinhkl
yknrvefdsaidlvleefsidivclagfmrilsgpfvqkwngkmlnihpsllpsfkgsna
heqaletgvtvtgctvhfvaedvdagqiilqeavpvkrgdtvatlservklaehkifpaa
lqlvasgtvqlgengkicwv

Timeline for d1zlxa_:

• d1zlxa_ first appeared in SCOP 1.73, called d1zlxa1
  
• d1zlxa_ was called d1zlxa1 in SCOP 1.75
  
• d1zlxa_ appears in SCOPe 2.02
  
• d1zlxa_ appears in the current release, SCOPe 2.08