Lineage for d1zlwm1 (1zlw M:1-112)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1510447Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1510625Species Human (Homo sapiens), cluster 3 [TaxId:9606] [88547] (33 PDB entries)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3)
  8. 1510687Domain d1zlwm1: 1zlw M:1-112 [125268]
    Other proteins in same PDB: d1zlwh2, d1zlwk1, d1zlwk2, d1zlwl1, d1zlwl2, d1zlwm2
    automatically matched to d1aqkh1
    complexed with man

Details for d1zlwm1

PDB Entry: 1zlw (more details), 2.85 Å

PDB Description: fab 2g12 + man8
PDB Compounds: (M:) FAB 2G12, heavy chain

SCOPe Domain Sequences for d1zlwm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zlwm1 b.1.1.1 (M:1-112) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]}
evqlvesggglvkaggslilscgvsnfrisahtmnwvrrvpggglewvasistsstyrdy
adavkgrftvsrddledfvylqmhkmrvedtaiyycarkgsdrlsdndpfdawgpgtvvt
vs

SCOPe Domain Coordinates for d1zlwm1:

Click to download the PDB-style file with coordinates for d1zlwm1.
(The format of our PDB-style files is described here.)

Timeline for d1zlwm1: