Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
Protein Class pi GST [81358] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [52864] (59 PDB entries) |
Domain d1zgnb2: 1zgn B:2-76 [125058] Other proteins in same PDB: d1zgna1, d1zgnb1 automated match to d1aqwa2 complexed with fe, gsh, mes, no |
PDB Entry: 1zgn (more details), 2.1 Å
SCOPe Domain Sequences for d1zgnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zgnb2 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt lyqsntilrhlgrtl
Timeline for d1zgnb2: