SCOPe 2.06: Domain d1zgnb2: 1zgn B:2-76

Lineage for d1zgnb2 (1zgn B:2-76)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (59 PDB entries)

8. Domain d1zgnb2: 1zgn B:2-76 [125058]
   Other proteins in same PDB: d1zgna1, d1zgnb1
   automated match to d1aqwa2
   complexed with fe, gsh, mes, no

Details for d1zgnb2

PDB Entry: 1zgn, 2.1 Å

PDB Description: crystal structure of the glutathione transferase pi in complex with dinitrosyl-diglutathionyl iron complex

PDB Compounds: (B:) Glutathione S-transferase P

SCOPe Domain Sequences for d1zgnb2:

Sequence; same for both SEQRES and ATOM records:

>d1zgnb2 c.47.1.5 (B:2-76) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdlt
lyqsntilrhlgrtl

Timeline for d1zgnb2:

• d1zgnb2 first appeared in SCOP 1.73
  
• d1zgnb2 appears in SCOPe 2.05
  
• d1zgnb2 appears in SCOPe 2.07
  
• d1zgnb2 appears in the current release, SCOPe 2.08