Class b: All beta proteins [48724] (174 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (1 family) |
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) |
Protein FimC [49588] (1 species) |
Species Escherichia coli [TaxId:562] [49589] (6 PDB entries) |
Domain d1ze3c2: 1ze3 C:122-205 [124975] Other proteins in same PDB: d1ze3c1, d1ze3d1, d1ze3h1 automatically matched to d1bf8_2 complexed with edo |
PDB Entry: 1ze3 (more details), 1.84 Å
SCOPe Domain Sequences for d1ze3c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ze3c2 b.7.2.1 (C:122-205) FimC {Escherichia coli [TaxId: 562]} lppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgestvklpsda gsnityrtindygaltpkmtgvme
Timeline for d1ze3c2: