Lineage for d1z8ld2 (1z8l D:118-350)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1834037Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 1834170Superfamily c.8.4: PA domain [52025] (1 family) (S)
  5. 1834171Family c.8.4.1: PA domain [52026] (2 proteins)
  6. 1834172Protein Glutamate carboxypeptidase II [141984] (1 species)
  7. 1834173Species Human (Homo sapiens) [TaxId:9606] [141985] (23 PDB entries)
    Uniprot Q04609 118-350
  8. 1834199Domain d1z8ld2: 1z8l D:118-350 [124716]
    Other proteins in same PDB: d1z8la1, d1z8la3, d1z8lb1, d1z8lb3, d1z8lc1, d1z8lc3, d1z8ld1, d1z8ld3
    automatically matched to 2C6C A:118-350
    complexed with nag, zn

Details for d1z8ld2

PDB Entry: 1z8l (more details), 3.5 Å

PDB Description: crystal structure of prostate-specific membrane antigen, a tumor marker and peptidase
PDB Compounds: (D:) glutamate carboxypeptidase II

SCOPe Domain Sequences for d1z8ld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z8ld2 c.8.4.1 (D:118-350) Glutamate carboxypeptidase II {Human (Homo sapiens) [TaxId: 9606]}
sypnkthpnyisiinedgneifntslfeppppgyenvsdivppfsafspqgmpegdlvyv
nyartedffklerdmkincsgkiviarygkvfrgnkvknaqlagakgvilysdpadyfap
gvksypdgwnlpgggvqrgnilnlngagdpltpgypaneyayrrgiaeavglpsipvhpi
gyydaqkllekmggsappdsswrgslkvpynvgpgftgnfstqkvkmhihstn

SCOPe Domain Coordinates for d1z8ld2:

Click to download the PDB-style file with coordinates for d1z8ld2.
(The format of our PDB-style files is described here.)

Timeline for d1z8ld2: