Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) |
Family c.23.10.6: Hypothetical protein alr1529 [102240] (1 protein) automatically mapped to Pfam PF13472 automatically mapped to Pfam PF00657 |
Protein Hypothetical protein alr1529 [102241] (1 species) putative lipase |
Species Nostoc sp. PCC 7120 [TaxId:103690] [102242] (2 PDB entries) |
Domain d1z8hb_: 1z8h B: [124700] automated match to d1vjga_ complexed with ipa, unl |
PDB Entry: 1z8h (more details), 2.02 Å
SCOPe Domain Sequences for d1z8hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z8hb_ c.23.10.6 (B:) Hypothetical protein alr1529 {Nostoc sp. PCC 7120 [TaxId: 103690]} tqiricfvgdsfvngtgdpeclgwtgrvcvnankkgydvtyynlgirrdtssdiakrwlq evslrlhkeynslvvfsfglndttlengkprvsiaetikntreiltqakklypvlmispa pyieqqdpgrrrrtidlsqqlalvcqdldvpyldvfpllekpsvwlheakandgvhpqag gytefarivenwdawlnwf
Timeline for d1z8hb_: