SCOPe 2.04: Domain d1z7zi1: 1z7z I:83-187

Lineage for d1z7zi1 (1z7z I:83-187)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.3: C2 set domains [49142] (8 proteins)

6. Protein Intercellular cell adhesion molecule-1 (ICAM-1) [49145] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49146] (6 PDB entries)

8. Domain d1z7zi1: 1z7z I:83-187 [124680]
   Other proteins in same PDB: d1z7zi3, d1z7zi4, d1z7zi5
   automatically matched to d1ic1a1
   complexed with nag, ndg

Details for d1z7zi1

PDB Entry: 1z7z, 8 Å

PDB Description: cryo-em structure of human coxsackievirus a21 complexed with five domain icam-1kilifi

PDB Compounds: (I:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1z7zi1:

Sequence; same for both SEQRES and ATOM records:

>d1z7zi1 b.1.1.3 (I:83-187) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]}
ywtpervelaplpswqpvgknltlrcqveggapranltvvllrgekelkrepavgepaev
tttvlvrrdhhganfscrteldlrpqglelfentsapyqlqtfvl

Timeline for d1z7zi1:

• d1z7zi1 first appeared in SCOP 1.73
  
• d1z7zi1 appears in SCOPe 2.03
  
• d1z7zi1 appears in SCOPe 2.05
  
• d1z7zi1 appears in the current release, SCOPe 2.08