![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families) ![]() |
![]() | Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
![]() | Protein ATP phosphoribosyltransferase regulatory subunit HisZ [118058] (2 species) shares histidine-binding site with the HisRS catalytic domain |
![]() | Species Lactococcus lactis [TaxId:1358] [143639] (2 PDB entries) Uniprot Q02147 6-323 |
![]() | Domain d1z7mb1: 1z7m B:6-323 [124633] Other proteins in same PDB: d1z7me1, d1z7mf_, d1z7mg_, d1z7mh_ automatically matched to 1Z7M A:6-323 complexed with po4, wo4 |
PDB Entry: 1z7m (more details), 2.9 Å
SCOPe Domain Sequences for d1z7mb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z7mb1 d.104.1.1 (B:6-323) ATP phosphoribosyltransferase regulatory subunit HisZ {Lactococcus lactis [TaxId: 1358]} yllpeesaemtlnqvkslrqiegrlrklfslknyqevmppsfeytqlytalesngktfnq ekmfqfikhegqsitlrydftlplvrlysqikdstsarysyfgkifrkekrhkgrsteny qigielfgesadkseleilslalqvieqlglnktvfeigsakffqrlcqladgstellte lllkkdlsglnafieknnfskelrgllkeifitnelsrlenlvtntkddvlissfdqlke fseklsmikpiiidlgmvpkmdyytdlmfkayssaanqpilsggrydqllsnfqeeafai gfcchmdtilkalerqel
Timeline for d1z7mb1: