SCOPe 2.04: Domain d1z72b_: 1z72 B:

Lineage for d1z72b_ (1z72 B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (8 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [186901] (1 PDB entry)

8. Domain d1z72b_: 1z72 B: [124584]
   automated match to d1to9b_
   complexed with acy, mg

Details for d1z72b_

PDB Entry: 1z72, 1.45 Å

PDB Description: Structure of a putative transcriptional regulator from Streptococcus pneumoniae

PDB Compounds: (B:) Transcriptional regulator, putative

SCOPe Domain Sequences for d1z72b_:

Sequence, based on SEQRES records:

>d1z72b_ a.132.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafl
smlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkaf
qdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvq
flvdelnrvgknredltelqqrwnqavalelaffdigy

Sequence, based on observed residues (ATOM records):

>d1z72b_ a.132.1.0 (B:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
tqdyafqpgltvgellkssqkdwqaainhrfvkelfagtienkvlkdyliqdyhffdafl
smlgacvahadklesklrfakqlgfleadedgyfqkafkelkvaendylevtlhpvtkaf
qdlmysavassdyahllvmlviaeglyldwgskdlalpevyihsewinlhrgpffaewvq
flvdelnrvgkrltelqqrwnqavalelaffdigy

Timeline for d1z72b_:

• d1z72b_ first appeared in SCOP 1.73, called d1z72b1
  
• d1z72b_ appears in SCOPe 2.03
  
• d1z72b_ appears in SCOPe 2.05
  
• d1z72b_ appears in the current release, SCOPe 2.08