Lineage for d1z6ol1 (1z6o L:13-212)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766021Protein (Apo)ferritin [47246] (7 species)
  7. 766066Species Cabbage looper(Trichoplusia ni), L chain [TaxId:7111] [140436] (1 PDB entry)
    Uniprot Q52SA8 1-200
  8. 766078Domain d1z6ol1: 1z6o L:13-212 [124542]
    automatically matched to 1Z6O A:13-212
    complexed with ca, fe

Details for d1z6ol1

PDB Entry: 1z6o (more details), 1.91 Å

PDB Description: Crystal Structure of Trichoplusia ni secreted ferritin
PDB Compounds: (L:) ferritin light chain

SCOP Domain Sequences for d1z6ol1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z6ol1 a.25.1.1 (L:13-212) (Apo)ferritin {Cabbage looper(Trichoplusia ni), L chain [TaxId: 7111]}
gitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaayfnnyqtnragf
sklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaenhelealakaldt
qkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlaghtsdlkkfitan
nghdlslalyvfdeylqktv

SCOP Domain Coordinates for d1z6ol1:

Click to download the PDB-style file with coordinates for d1z6ol1.
(The format of our PDB-style files is described here.)

Timeline for d1z6ol1: