PDB entry 1z6o

View 1z6o on RCSB PDB site
Description: Crystal Structure of Trichoplusia ni secreted ferritin
Class: metal binding protein
Keywords: METAL BINDING PROTEIN,Iron storage
Deposited on 2005-03-22, released 2005-05-24
The last revision prior to the SCOP 1.75 freeze date was dated 2005-05-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.189
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6oa1
  • Chain 'B':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6ob1
  • Chain 'C':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6oc1
  • Chain 'D':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6od1
  • Chain 'E':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6oe1
  • Chain 'F':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6of1
  • Chain 'G':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6og1
  • Chain 'H':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6oh1
  • Chain 'I':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6oi1
  • Chain 'J':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6oj1
  • Chain 'K':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6ok1
  • Chain 'L':
    Compound: ferritin light chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6ol1
  • Chain 'M':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6om1
  • Chain 'N':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6on1
  • Chain 'O':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6oo1
  • Chain 'P':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6op1
  • Chain 'Q':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6oq1
  • Chain 'R':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6or1
  • Chain 'S':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6os1
  • Chain 'T':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6ot1
  • Chain 'U':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6ou1
  • Chain 'V':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6ov1
  • Chain 'W':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6ow1
  • Chain 'X':
    Compound: ferritin heavy chain
    Species: Trichoplusia ni
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1z6ox1
  • Heterogens: FE, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oA (A:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oB (B:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oC (C:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oD (D:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oE (E:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oF (F:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oG (G:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oH (H:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oI (I:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oJ (J:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oK (K:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oL (L:)
    adtcyndvaldcgitsnslalprcnavygeygshgnvatelqayaklhlersydyllsaa
    yfnnyqtnragfsklfkklsdeawsktidiikhvtkrgdkmnfdqhstmkterknytaen
    helealakaldtqkelaerafyihreatrnsqhlhdpeiaqyleeefiedhaekirtlag
    htsdlkkfitannghdlslalyvfdeylqktv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oM (M:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oN (N:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oO (O:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oP (P:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oQ (Q:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oR (R:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oS (S:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oT (T:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oU (U:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oV (V:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oW (W:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1z6oX (X:)
    tqcnvnpvqipkdwitmhrscrnsmrqqiqmevgaslqylamgahfskdvvnrpgfaqlf
    fdaaseerehamklieyllmrgeltndvssllqvrpptrsswkggvealehalsmesdvt
    ksirnvikaceddsefndyhlvdyltgdfleeqykgqrdlagkastlkklmdrhealgef
    ifdkkllgidv