SCOPe 2.08: Domain d1z5lc2: 1z5l C:7-185

Lineage for d1z5lc2 (1z5l C:7-185)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d1z5lc2: 1z5l C:7-185 [124484]
   Other proteins in same PDB: d1z5la1, d1z5lb_, d1z5lc1, d1z5ld_
   automated match to d1onqa2
   complexed with nag, pbs, r16

Details for d1z5lc2

PDB Entry: 1z5l, 2.2 Å

PDB Description: structure of a highly potent short-chain galactosyl ceramide agonist bound to cd1d

PDB Compounds: (C:) T-cell surface glycoprotein CD1d antigen

SCOPe Domain Sequences for d1z5lc2:

Sequence, based on SEQRES records:

>d1z5lc2 d.19.1.0 (C:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records):

>d1z5lc2 d.19.1.0 (C:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemysesflhvafqgkyvvrfwg
tswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d1z5lc2:

• d1z5lc2 first appeared in SCOP 1.73
  
• d1z5lc2 appears in SCOPe 2.07