Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (33 PDB entries) |
Domain d1z5la2: 1z5l A:8-185 [124481] Other proteins in same PDB: d1z5la1, d1z5lb_, d1z5lc1, d1z5ld_ automated match to d1onqa2 complexed with nag, pbs, r16 |
PDB Entry: 1z5l (more details), 2.2 Å
SCOPe Domain Sequences for d1z5la2:
Sequence, based on SEQRES records: (download)
>d1z5la2 d.19.1.0 (A:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
>d1z5la2 d.19.1.0 (A:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypsesflhvafqgkyvvrfwg tswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d1z5la2:
View in 3D Domains from other chains: (mouse over for more information) d1z5lb_, d1z5lc1, d1z5lc2, d1z5ld_ |