Lineage for d1z4ia1 (1z4i A:34-227)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2167270Family c.108.1.8: 5'(3')-deoxyribonucleotidase (dNT-2) [82382] (2 proteins)
    the insertion subdomain is a 4-helical bundle; dephosphorylates dUMP and dTMP
    automatically mapped to Pfam PF06941
  6. 2167271Protein 5'(3')-deoxyribonucleotidase (dNT-2) [82383] (1 species)
  7. 2167272Species Human (Homo sapiens) [TaxId:9606] [82384] (4 PDB entries)
  8. 2167275Domain d1z4ia1: 1z4i A:34-227 [124433]
    complexed with gol, mg, ump

Details for d1z4ia1

PDB Entry: 1z4i (more details), 1.98 Å

PDB Description: structure of the d41n variant of the human mitochondrial deoxyribonucleotidase in complex with deoxyribouridine 5'- monophosphate
PDB Compounds: (A:) 5'(3')-deoxyribonucleotidase

SCOPe Domain Sequences for d1z4ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z4ia1 c.108.1.8 (A:34-227) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]}
ralrvlvnmdgvladfeggflrkfrarfpdqpfialedrrgfwvseqygrlrpglsekai
siwesknfffeleplpgaveavkemaslqntdvfictspikmfkycpyekyawvekyfgp
dfleqivltrdktvvsadlliddrpditgaeptpswehvlftachnqhlqlqpprrrlhs
waddwkaildskrp

SCOPe Domain Coordinates for d1z4ia1:

Click to download the PDB-style file with coordinates for d1z4ia1.
(The format of our PDB-style files is described here.)

Timeline for d1z4ia1: