SCOPe 2.02: Domain d1z2xb_: 1z2x B:

Lineage for d1z2xb_ (1z2x B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (4 proteins)

6. Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [143936] (3 PDB entries)
   Uniprot Q9QZ88 1-182

8. Domain d1z2xb_: 1z2x B: [124393]
   automated match to d1z2wa1

Details for d1z2xb_

PDB Entry: 1z2x, 2.22 Å

PDB Description: Crystal structure of mouse Vps29

PDB Compounds: (B:) vacuolar protein sorting 29

SCOPe Domain Sequences for d1z2xb_:

Sequence; same for both SEQRES and ATOM records:

>d1z2xb_ d.159.1.7 (B:) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}
mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
ks

Timeline for d1z2xb_:

• d1z2xb_ first appeared in SCOP 1.73, called d1z2xb1
  
• d1z2xb_ appears in SCOPe 2.01
  
• d1z2xb_ appears in SCOPe 2.03
  
• d1z2xb_ appears in the current release, SCOPe 2.08