SCOPe 2.02: Domain d1z21a1: 1z21 A:42-145

Lineage for d1z21a1 (1z21 A:42-145)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.243: Type III secretion system domain [140590] (1 superfamily)
   core: 4 helices, orthogonal array; right-handed superhelix

4. Superfamily a.243.1: Type III secretion system domain [140591] (3 families)

5. Family a.243.1.2: YopR Core [140595] (1 protein)
   Pfam PF09025, contains extra N-terminal helix

6. Protein Yop proteins translocation protein H, YscH (IcrP) [140596] (1 species)

7. Species Yersinia pestis [TaxId:632] [140597] (1 PDB entry)
   Uniprot P68590 42-145

8. Domain d1z21a1: 1z21 A:42-145 [124367]

Details for d1z21a1

PDB Entry: 1z21, 1.5 Å

PDB Description: Crystal structure of the core domain of Yersinia pestis virulence factor YopR

PDB Compounds: (A:) Yop proteins translocation protein H

SCOPe Domain Sequences for d1z21a1:

Sequence, based on SEQRES records:

>d1z21a1 a.243.1.2 (A:42-145) Yop proteins translocation protein H, YscH (IcrP) {Yersinia pestis [TaxId: 632]}
saektrevlwqqyyasnppdhavlevlatpvreallarfgqhqgsvvpaidlpelrsvlq
qfdsfgkrweaillqvlegikpnesqvglpylselinkelmill

Sequence, based on observed residues (ATOM records):

>d1z21a1 a.243.1.2 (A:42-145) Yop proteins translocation protein H, YscH (IcrP) {Yersinia pestis [TaxId: 632]}
saektrevlwqqyyasnppdhavlevlatpvreallarfgqhqgsvvpaidlpelrsvlq
qfdsfgkrweaillqvlegilpylselinkelmill

Timeline for d1z21a1:

• d1z21a1 first appeared in SCOP 1.73
  
• d1z21a1 appears in SCOPe 2.01
  
• d1z21a1 appears in SCOPe 2.03
  
• d1z21a1 appears in the current release, SCOPe 2.08