Lineage for d1z1db1 (1z1d B:1-131)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211733Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 1211734Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 1211735Family d.89.1.1: The origin DNA-binding domain of SV40 T-antigen [55465] (2 proteins)
  6. 1211736Protein The origin DNA-binding domain of SV40 T-antigen [55466] (1 species)
  7. 1211737Species Simian virus 40, Sv40 [TaxId:10633] [55467] (11 PDB entries)
  8. 1211751Domain d1z1db1: 1z1d B:1-131 [124352]
    Other proteins in same PDB: d1z1da1
    automatically matched to d1tbd__

Details for d1z1db1

PDB Entry: 1z1d (more details)

PDB Description: structural model for the interaction between rpa32 c-terminal domain and sv40 t antigen origin binding domain.
PDB Compounds: (B:) large t antigen

SCOPe Domain Sequences for d1z1db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z1db1 d.89.1.1 (B:1-131) The origin DNA-binding domain of SV40 T-antigen {Simian virus 40, Sv40 [TaxId: 10633]}
gskvedpkdfpsellsflshavfsnrtlacfaiyttkekaallykkimekysvtfisrhn
synhnilffltphrhrvsainnyaqklctfsflickgvnkeylmysaltrdpfsvieesl
pgglkehdfnp

SCOPe Domain Coordinates for d1z1db1:

Click to download the PDB-style file with coordinates for d1z1db1.
(The format of our PDB-style files is described here.)

Timeline for d1z1db1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1z1da1