Lineage for d1z0kd_ (1z0k D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904677Superfamily a.2.19: Rabenosyn-5 Rab-binding domain-like [140125] (1 family) (S)
  5. 904678Family a.2.19.1: Rabenosyn-5 Rab-binding domain-like [140126] (2 proteins)
  6. 904684Protein automated matches [190845] (1 species)
    not a true protein
  7. 904685Species Human (Homo sapiens) [TaxId:9606] [188164] (1 PDB entry)
  8. 904686Domain d1z0kd_: 1z0k D: [124324]
    Other proteins in same PDB: d1z0ka1, d1z0kb1, d1z0kc_
    automated match to d1z0kb1
    complexed with gtp, mes, mg

Details for d1z0kd_

PDB Entry: 1z0k (more details), 1.92 Å

PDB Description: structure of gtp-bound rab4q67l gtpase in complex with the central rab binding domain of rabenosyn-5
PDB Compounds: (D:) FYVE-finger-containing Rab5 effector protein rabenosyn-5

SCOPe Domain Sequences for d1z0kd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z0kd_ a.2.19.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egwlplsggqgqsedsdpllqqihnitsfirqakaagrmdevrtlqenlrqlqdeydqqq
t

SCOPe Domain Coordinates for d1z0kd_:

Click to download the PDB-style file with coordinates for d1z0kd_.
(The format of our PDB-style files is described here.)

Timeline for d1z0kd_: