Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
Protein Transcriptional regulator VC2007 [142479] (1 species) |
Species Vibrio cholerae [TaxId:666] [142480] (1 PDB entry) Uniprot Q9KQJ1 209-405! Uniprot Q9KQJ1 81-208 |
Domain d1z05a3: 1z05 A:81-208 [124300] Other proteins in same PDB: d1z05a1 complexed with bme, gol, so4, zn |
PDB Entry: 1z05 (more details), 2 Å
SCOPe Domain Sequences for d1z05a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z05a3 c.55.1.10 (A:81-208) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} nlgwqflsmrlgrgyltialhelggevlidtkidiheidqddvlarllfeieeffqtyaa qldrvtsiaitlpglvnseqgivlqmphynvknlalgpeiykatglpvfvandtrawala eklfghsq
Timeline for d1z05a3: