SCOPe 2.01: Domain d1z00a1: 1z00 A:220-297

Lineage for d1z00a1 (1z00 A:220-297)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.5: Hef domain-like [140629] (3 proteins)
   helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)

6. Protein DNA excision repair protein ERCC-1 [140630] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140631] (2 PDB entries)
   Uniprot P07992 219-296! Uniprot P07992 220-297

8. Domain d1z00a1: 1z00 A:220-297 [124294]
   Other proteins in same PDB: d1z00b1

Details for d1z00a1

PDB Entry: 1z00

PDB Description: solution structure of the c-terminal domain of ercc1 complexed with the c-terminal domain of xpf

PDB Compounds: (A:) DNA excision repair protein ERCC-1

SCOPe Domain Sequences for d1z00a1:

Sequence; same for both SEQRES and ATOM records:

>d1z00a1 a.60.2.5 (A:220-297) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]}
adllmekleqdfvsrvteclttvksvnktdsqtllttfgsleqliaasredlalcpglgp
qkarrlfdvlhepflkvp

Timeline for d1z00a1:

• d1z00a1 first appeared in SCOP 1.73
  
• d1z00a1 appears in SCOP 1.75
  
• d1z00a1 appears in SCOPe 2.02
  
• d1z00a1 appears in the current release, SCOPe 2.08