Class a: All alpha proteins [46456] (284 folds) |
Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein) Pfam PF01503 |
Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (5 species) |
Species Streptomyces coelicolor [TaxId:1902] [140799] (1 PDB entry) Uniprot Q9EWK0 4-91 |
Domain d1yxbg_: 1yxb G: [124181] automated match to d1yxba1 |
PDB Entry: 1yxb (more details), 2.6 Å
SCOPe Domain Sequences for d1yxbg_:
Sequence, based on SEQRES records: (download)
>d1yxbg_ a.204.1.4 (G:) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]} ktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaae eisqllyhvqvmmvargislddvyahll
>d1yxbg_ a.204.1.4 (G:) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]} ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq llyhvqvmmvargislddvyahll
Timeline for d1yxbg_: