Lineage for d1yupb_ (1yup B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1132927Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1132928Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1132929Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1133269Protein automated matches [190163] (10 species)
    not a true protein
  7. 1133320Species Reindeer (Rangifer tarandus) [TaxId:9870] [186888] (1 PDB entry)
  8. 1133321Domain d1yupb_: 1yup B: [124057]
    Other proteins in same PDB: d1yupa1, d1yupe_, d1yuph_
    automated match to d1bsqa_

Details for d1yupb_

PDB Entry: 1yup (more details), 2.1 Å

PDB Description: reindeer beta-lactoglobulin
PDB Compounds: (B:) beta-lactoglobulin

SCOPe Domain Sequences for d1yupb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yupb_ b.60.1.1 (B:) automated matches {Reindeer (Rangifer tarandus) [TaxId: 9870]}
vtqtmkdldvqkvagtwyslamaasdislldaqsaplrvyveelkptpggdleillqkwe
ngkcaqkkiiaekteipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqcl
vrtpevddeamekfdkalkalpmhirlsfnptqleeqc

SCOPe Domain Coordinates for d1yupb_:

Click to download the PDB-style file with coordinates for d1yupb_.
(The format of our PDB-style files is described here.)

Timeline for d1yupb_: