Lineage for d1yqaa1 (1yqa A:171-257)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 906324Family a.4.5.13: Linker histone H1/H5 [46827] (3 proteins)
  6. 906325Protein Histone H1 homologue Hho1p [101037] (1 species)
    duplication: contains two similar globular domains
  7. 906326Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101038] (4 PDB entries)
  8. 906327Domain d1yqaa1: 1yqa A:171-257 [123875]

Details for d1yqaa1

PDB Entry: 1yqa (more details)

PDB Description: engineering the structural stability and functional properties of the gi domain into the intrinsically unfolded gii domain of the yeast linker histone hho1p
PDB Compounds: (A:) Histone H1

SCOPe Domain Sequences for d1yqaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqaa1 a.4.5.13 (A:171-257) Histone H1 homologue Hho1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kasspssltykemilksmpqlndgkgssrivlkkyvkdtypivgsasnfdylfnsaikkc
vengelvqpkgpsgiiklnkkkvklst

SCOPe Domain Coordinates for d1yqaa1:

Click to download the PDB-style file with coordinates for d1yqaa1.
(The format of our PDB-style files is described here.)

Timeline for d1yqaa1: