SCOPe 2.03: Domain d1yn6b_: 1yn6 B:

Lineage for d1yn6b_ (1yn6 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries)
   Uniprot P01887

8. Domain d1yn6b_: 1yn6 B: [123714]
   Other proteins in same PDB: d1yn6a1, d1yn6a2
   automated match to d1bz9b_

Details for d1yn6b_

PDB Entry: 1yn6, 2.2 Å

PDB Description: Crystal structure of a mouse MHC class I protein, H2-Db, in complex with a peptide from the influenza A acid polymerase

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1yn6b_:

Sequence; same for both SEQRES and ATOM records:

>d1yn6b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1yn6b_:

• d1yn6b_ first appeared in SCOP 1.73, called d1yn6b1
  
• d1yn6b_ appears in SCOPe 2.02
  
• d1yn6b_ appears in SCOPe 2.04
  
• d1yn6b_ appears in the current release, SCOPe 2.08, called d1yn6b2