Lineage for d1yl4u1 (1yl4 U:16-88)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763283Superfamily a.4.8: Ribosomal protein S18 [46911] (1 family) (S)
  5. 763284Family a.4.8.1: Ribosomal protein S18 [46912] (1 protein)
  6. 763285Protein Ribosomal protein S18 [46913] (2 species)
  7. 763311Species Thermus thermophilus [TaxId:274] [46914] (47 PDB entries)
    Uniprot P80382
  8. 763354Domain d1yl4u1: 1yl4 U:16-88 [123614]
    Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4i1, d1yl4j1, d1yl4k1, d1yl4l1, d1yl4m1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4q1, d1yl4r1, d1yl4s1, d1yl4t1, d1yl4v1, d1yl4w1, d1yl4x1
    automatically matched to d1i94r_

Details for d1yl4u1

PDB Entry: 1yl4 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. 30S subunit. The coordinates for the 50S subunit are in the pdb entry 1YL3
PDB Compounds: (U:) 30S ribosomal protein S18

SCOP Domain Sequences for d1yl4u1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl4u1 a.4.8.1 (U:16-88) Ribosomal protein S18 {Thermus thermophilus [TaxId: 274]}
psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
lgllpfteklvrk

SCOP Domain Coordinates for d1yl4u1:

Click to download the PDB-style file with coordinates for d1yl4u1.
(The format of our PDB-style files is described here.)

Timeline for d1yl4u1: