Lineage for d1yl4r1 (1yl4 R:2-89)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764625Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 764626Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 764635Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 764636Protein Ribosomal protein S15 [47065] (3 species)
  7. 764650Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 764688Domain d1yl4r1: 1yl4 R:2-89 [123611]
    Other proteins in same PDB: d1yl4e1, d1yl4f1, d1yl4f2, d1yl4g1, d1yl4h1, d1yl4h2, d1yl4i1, d1yl4j1, d1yl4k1, d1yl4l1, d1yl4m1, d1yl4n1, d1yl4o1, d1yl4p1, d1yl4q1, d1yl4s1, d1yl4t1, d1yl4u1, d1yl4v1, d1yl4w1, d1yl4x1
    automatically matched to d1ab3__

Details for d1yl4r1

PDB Entry: 1yl4 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. 30S subunit. The coordinates for the 50S subunit are in the pdb entry 1YL3
PDB Compounds: (R:) 30S ribosomal protein S15

SCOP Domain Sequences for d1yl4r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yl4r1 a.16.1.2 (R:2-89) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1yl4r1:

Click to download the PDB-style file with coordinates for d1yl4r1.
(The format of our PDB-style files is described here.)

Timeline for d1yl4r1: