SCOPe 2.05: Domain d1yjn31: 1yjn 3:1-92

Lineage for d1yjn31 (1yjn 3:1-92)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.3: Ribosomal protein L44e [57836] (1 protein)
   automatically mapped to Pfam PF00935

6. Protein Ribosomal protein L44e [57837] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57838] (40 PDB entries)
   Uniprot P32411

8. Domain d1yjn31: 1yjn 3:1-92 [123431]
   Other proteins in same PDB: d1yjn11, d1yjn21, d1yjna1, d1yjna2, d1yjnb1, d1yjnc1, d1yjnd1, d1yjne1, d1yjne2, d1yjnf1, d1yjng1, d1yjnh1, d1yjni1, d1yjnj1, d1yjnk1, d1yjnl1, d1yjnm1, d1yjnn1, d1yjno1, d1yjnp1, d1yjnq1, d1yjnr1, d1yjns1, d1yjnt1, d1yjnu1, d1yjnv1, d1yjnw1, d1yjnx1, d1yjny1, d1yjnz1
   automatically matched to d1ffkz_
   complexed with cd, cl, cly, k, mg, na; mutant

Details for d1yjn31

PDB Entry: 1yjn, 3 Å

PDB Description: crystal structure of clindamycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui

PDB Compounds: (3:) 50S ribosomal protein L44E

SCOPe Domain Sequences for d1yjn31:

Sequence; same for both SEQRES and ATOM records:

>d1yjn31 g.41.8.3 (3:1-92) Ribosomal protein L44e {Haloarcula marismortui [TaxId: 2238]}
mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
ptkktdlkyrcgecgkahlregwragrlefqe

Timeline for d1yjn31:

• d1yjn31 first appeared in SCOP 1.73
  
• d1yjn31 appears in SCOPe 2.04
  
• d1yjn31 appears in SCOPe 2.06
  
• d1yjn31 appears in the current release, SCOPe 2.08