Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (8 species) not a true protein |
Species Leishmania major [TaxId:5664] [188133] (1 PDB entry) |
Domain d1yf9c_: 1yf9 C: [123056] Other proteins in same PDB: d1yf9a1 automated match to d1yf9a1 complexed with cl |
PDB Entry: 1yf9 (more details), 2 Å
SCOPe Domain Sequences for d1yf9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yf9c_ d.20.1.1 (C:) automated matches {Leishmania major [TaxId: 5664]} snrrremdymrlcnstrkvypsdtvaefwvefkgpegtpyedgtwmlhvqlpsdypfksp sigfcnrilhpnvdersgsvcldvinqtwtpmyqlenifdvflpqllrypnpsdplnvqa ahllhadrvgfdallrehvsthatpqkalesipeayrph
Timeline for d1yf9c_: