SCOPe 2.04: Domain d1y7uc_: 1y7u C:

Lineage for d1y7uc_ (1y7u C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (26 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [186868] (1 PDB entry)

8. Domain d1y7uc_: 1y7u C: [122724]
   Other proteins in same PDB: d1y7ua1
   automated match to d1vpma_
   complexed with ca, coa, so4

Details for d1y7uc_

PDB Entry: 1y7u, 2.8 Å

PDB Description: Crystal Structure of Acyl-Coa hydrolase from Bacillus cereus

PDB Compounds: (C:) acyl-CoA hydrolase

SCOPe Domain Sequences for d1y7uc_:

Sequence; same for both SEQRES and ATOM records:

>d1y7uc_ d.38.1.0 (C:) automated matches {Bacillus cereus [TaxId: 1396]}
kgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrkecvtasmdwv
dflhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfvtfvalskenn
pvpvprvipdteeekeshriavlraeqrhirkaeskkvatlltf

Timeline for d1y7uc_:

• d1y7uc_ first appeared in SCOP 1.73, called d1y7uc1
  
• d1y7uc_ appears in SCOPe 2.03
  
• d1y7uc_ appears in SCOPe 2.05
  
• d1y7uc_ appears in the current release, SCOPe 2.08