Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) |
Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
Protein automated matches [190143] (26 species) not a true protein |
Species Bacillus cereus [TaxId:1396] [186868] (1 PDB entry) |
Domain d1y7uc_: 1y7u C: [122724] Other proteins in same PDB: d1y7ua1 automated match to d1vpma_ complexed with ca, coa, so4 |
PDB Entry: 1y7u (more details), 2.8 Å
SCOPe Domain Sequences for d1y7uc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7uc_ d.38.1.0 (C:) automated matches {Bacillus cereus [TaxId: 1396]} kgktanesrvfktsrvfptdlndhntlfggkilsemdmvasisasrhsrkecvtasmdwv dflhpvrssdcvsyesfviwtgrtsmevfvkvvseylisgekriaatsfvtfvalskenn pvpvprvipdteeekeshriavlraeqrhirkaeskkvatlltf
Timeline for d1y7uc_: