Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Malate dehydrogenase [56329] (12 species) |
Species Thermus thermophilus [TaxId:274] [82806] (7 PDB entries) identical sequence to that from the Thermus flavus enzyme |
Domain d1y7tb2: 1y7t B:154-332 [122721] Other proteins in same PDB: d1y7ta1, d1y7tb1 automated match to d1iz9a2 complexed with ndp, trs |
PDB Entry: 1y7t (more details), 1.65 Å
SCOPe Domain Sequences for d1y7tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y7tb2 d.162.1.1 (B:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} mtrldhnrakaqlakktgtgvdrirrmtvwgnhsstmfpdlfhaevdgrpalelvdmewy ekvfiptvaqrgaaiiqargassaasaanaaiehirdwalgtpegdwvsmavpsqgeygi pegivysfpvtakdgayrvvegleinefarkrmeitaqelldemeqvkalgli
Timeline for d1y7tb2: