Lineage for d1xu3c_ (1xu3 C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991094Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1991179Protein Methane monooxygenase hydrolase beta subunit [88792] (2 species)
  7. 1991180Species Methylococcus capsulatus [TaxId:414] [88793] (27 PDB entries)
  8. 1991217Domain d1xu3c_: 1xu3 C: [122322]
    Other proteins in same PDB: d1xu3a_, d1xu3b_, d1xu3e_, d1xu3f_
    automated match to d1fyzc_
    complexed with bml, fe

Details for d1xu3c_

PDB Entry: 1xu3 (more details), 2.3 Å

PDB Description: Soluble methane monooxygenase hydroxylase-soaked with bromophenol
PDB Compounds: (C:) Methane monooxygenase component A beta chain

SCOPe Domain Sequences for d1xu3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xu3c_ a.25.1.2 (C:) Methane monooxygenase hydrolase beta subunit {Methylococcus capsulatus [TaxId: 414]}
smlgerrrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnad
wiaggldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytd
rflqgysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslaf
wgfdkidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdw
nesafsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyyn
clgddpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvd
dwiedyasridfkadrdqivkavlaglk

SCOPe Domain Coordinates for d1xu3c_:

Click to download the PDB-style file with coordinates for d1xu3c_.
(The format of our PDB-style files is described here.)

Timeline for d1xu3c_: