SCOPe 2.01: Domain d1xsxb1: 1xsx B:3-92

Lineage for d1xsxb1 (1xsx B:3-92)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.49: Archaeal DNA-binding protein [109677] (1 protein)
   contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers

6. Protein Sso10a (SSO10449) [109678] (1 species)

7. Species Sulfolobus solfataricus [TaxId:2287] [109679] (2 PDB entries)
   Uniprot Q5W1E8

8. Domain d1xsxb1: 1xsx B:3-92 [122290]
   automatically matched to d1r7ja_

Details for d1xsxb1

PDB Entry: 1xsx

PDB Description: nmr structure of sso10a, a hyperthermophile dna-binding protein with an extended anti-parallel coiled coil

PDB Compounds: (B:) Sso10a

SCOPe Domain Sequences for d1xsxb1:

Sequence; same for both SEQRES and ATOM records:

>d1xsxb1 a.4.5.49 (B:3-92) Sso10a (SSO10449) {Sulfolobus solfataricus [TaxId: 2287]}
kkskleiiqaileacksgspktrimyganlsyaltgryikmlmdleiirqegkqymltkk
geelledirkfnemrknmdqlkekinsvls

Timeline for d1xsxb1:

• d1xsxb1 first appeared in SCOP 1.73
  
• d1xsxb1 appears in SCOP 1.75
  
• d1xsxb1 appears in SCOPe 2.02
  
• d1xsxb1 appears in the current release, SCOPe 2.08, called d1xsxb_