Lineage for d1xl3b_ (1xl3 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738120Fold a.243: Type III secretion system domain [140590] (1 superfamily)
    core: 4 helices, orthogonal array; right-handed superhelix
  4. 2738121Superfamily a.243.1: Type III secretion system domain [140591] (3 families) (S)
  5. 2738131Family a.243.1.3: LcrE-like [140598] (1 protein)
    Duplication; contains two domains of this fold; Pfam PF07201 (HrpJ-like) covers the first domain and the N-terminal half of the second domain
  6. 2738132Protein Outer membrane protein yopN (LcrE) [140599] (1 species)
  7. 2738133Species Yersinia pestis [TaxId:632] [140600] (2 PDB entries)
    Uniprot P68640 73-269! Uniprot P68640 78-283
  8. 2738136Domain d1xl3b_: 1xl3 B: [122103]
    Other proteins in same PDB: d1xl3c1, d1xl3d_
    automated match to d1xl3a1

Details for d1xl3b_

PDB Entry: 1xl3 (more details), 2.2 Å

PDB Description: Complex structure of Y.pestis virulence Factors YopN and TyeA
PDB Compounds: (B:) Secretion control protein

SCOPe Domain Sequences for d1xl3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xl3b_ a.243.1.3 (B:) Outer membrane protein yopN (LcrE) {Yersinia pestis [TaxId: 632]}
arvsdveeqvnqylskvpeleqkqnvsellsllsnspnislsqlkaylegkseepseqfk
mlcglrdalkgrpelahlshlveqalvsmaeeqgetivlgaritpeayresqsgvnplqp
lrdtyrdavmgyqgiyaiwsdlqkrfpngdidsvilflqkalsadlqsqqsgsgreklgi
visdlqklkefgsvsdqvkgfwqffs

SCOPe Domain Coordinates for d1xl3b_:

Click to download the PDB-style file with coordinates for d1xl3b_.
(The format of our PDB-style files is described here.)

Timeline for d1xl3b_: