Class g: Small proteins [56992] (100 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Four and a half LIM domains protein 5, FHL-5 [144181] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [144182] (1 PDB entry) Uniprot Q5TD97 222-250! Uniprot Q5TD97 251-284 |
Domain d1x68a2: 1x68 A:37-70 [121736] Other proteins in same PDB: d1x68a3, d1x68a4 complexed with zn |
PDB Entry: 1x68 (more details)
SCOPe Domain Sequences for d1x68a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} ncgkcsvslvgkgfltqnkeifcqkcgsgmdtdi
Timeline for d1x68a2: