Lineage for d1x5za1 (1x5z A:8-109)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1767525Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1767526Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1767933Protein Receptor-type tyrosine-protein phosphatase delta, PTPRD [141049] (1 species)
  7. 1767934Species Human (Homo sapiens) [TaxId:9606] [141050] (2 PDB entries)
    Uniprot P23468 504-607
  8. 1767935Domain d1x5za1: 1x5z A:8-109 [121726]

Details for d1x5za1

PDB Entry: 1x5z (more details)

PDB Description: solution structure of the fibronectin type-iii domain of human protein tyrosine phosphatase, receptor type, d isoform 4 variant
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase delta

SCOPe Domain Sequences for d1x5za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]}
diqvitqtgvpgqplnfkaepesetsillswtpprsdtianyelvykdgehgeeqritie
pgtsyrlqglkpnslyyfrlaarspqglgastaeisartmqs

SCOPe Domain Coordinates for d1x5za1:

Click to download the PDB-style file with coordinates for d1x5za1.
(The format of our PDB-style files is described here.)

Timeline for d1x5za1: