Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein RNA-binding motif, single-stranded-interacting protein 2, RBMS2 [143320] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143321] (1 PDB entry) Uniprot Q15434 58-129 |
Domain d1x4ea1: 1x4e A:8-79 [121687] Other proteins in same PDB: d1x4ea2, d1x4ea3 |
PDB Entry: 1x4e (more details)
SCOPe Domain Sequences for d1x4ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} lyirglqpgttdqdlvklcqpygkivstkaildkttnkckgygfvdfdspsaaqkavtal kasgvqaqmakq
Timeline for d1x4ea1: