Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein p56-lck tyrosine kinase [55552] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [55553] (11 PDB entries) |
Domain d1x27d2: 1x27 D:119-226 [121628] Other proteins in same PDB: d1x27a1, d1x27b1, d1x27c1, d1x27d1, d1x27e1, d1x27f1 automatically matched to d1lcka2 complexed with na |
PDB Entry: 1x27 (more details), 2.7 Å
SCOPe Domain Sequences for d1x27d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x27d2 d.93.1.1 (D:119-226) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} anslepepwffknlsrkdaerqllapgnthgsfliresestagsfslsvrdfdqnqgevv khykirnldnggfyispritfpglhelvrhytnasdglctrlsrpcqt
Timeline for d1x27d2: