Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) contains a common phosphate-binding site |
Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins) |
Protein Methylglyoxal synthase, MgsA [52340] (3 species) |
Species Thermus thermophilus [TaxId:274] [142080] (1 PDB entry) Uniprot Q5SHD6 1-126 |
Domain d1wo8e_: 1wo8 E: [121114] automated match to d1wo8a1 complexed with so4 |
PDB Entry: 1wo8 (more details), 1.7 Å
SCOPe Domain Sequences for d1wo8e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wo8e_ c.24.1.2 (E:) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]} kalaliahdakkdemvafclrhkdvlarypllatgttgariqeatglavervlsgplggd lqigarvaegkvlavvflqdpltakphepdvqalmrvcnvhgvplatnlvaaealiawir kg
Timeline for d1wo8e_: