SCOPe 2.01: Domain d1wmaa1: 1wma A:2-276

Lineage for d1wmaa1 (1wma A:2-276)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein Carbonyl reductase/20beta-hydroxysteroid dehydrogenase [63935] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141878] (5 PDB entries)
   Uniprot P16152 2-276

8. Domain d1wmaa1: 1wma A:2-276 [121042]
   complexed with ab3, ndp, p33, pe5, so4

Details for d1wmaa1

PDB Entry: 1wma, 1.24 Å

PDB Description: Crystal structure of human CBR1 in complex with Hydroxy-PP

PDB Compounds: (A:) Carbonyl reductase [NADPH] 1

SCOPe Domain Sequences for d1wmaa1:

Sequence; same for both SEQRES and ATOM records:

>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
sgihvalvtggnkgiglaivrdlcrlfsgdvvltardvtrgqaavqqlqaeglsprfhql
diddlqsiralrdflrkeyggldvlvnnagiafkvadptpfhiqaevtmktnffgtrdvc
tellplikpqgrvvnvssimsvralkscspelqqkfrsetiteeelvglmnkfvedtkkg
vhqkegwpssaygvtkigvtvlsriharklseqrkgdkillnaccpgwvrtdmagpkatk
speegaetpvylallppdaegphgqfvsekrveqw

Timeline for d1wmaa1:

• d1wmaa1 first appeared in SCOP 1.73
  
• d1wmaa1 appears in SCOP 1.75
  
• d1wmaa1 appears in SCOPe 2.02
  
• d1wmaa1 appears in the current release, SCOPe 2.08