Lineage for d1wk9a_ (1wk9 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798370Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 1798371Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 1798372Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
    inserted into the catalytic domain
  6. 1798401Protein automated matches [226874] (1 species)
    not a true protein
  7. 1798402Species Thermus thermophilus [TaxId:274] [225032] (4 PDB entries)
  8. 1798406Domain d1wk9a_: 1wk9 A: [120977]
    automated match to d1wkaa1
    complexed with tsb

Details for d1wk9a_

PDB Entry: 1wk9 (more details), 1.75 Å

PDB Description: Structural basis for non-cognate amino acid discrimination by the valyl-tRNA synthetase editing domain
PDB Compounds: (A:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1wk9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wk9a_ b.51.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
gklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkraripltevwipi
ladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpealrgldr
fearrkavelfreaghlvkeedy

SCOPe Domain Coordinates for d1wk9a_:

Click to download the PDB-style file with coordinates for d1wk9a_.
(The format of our PDB-style files is described here.)

Timeline for d1wk9a_: