SCOPe 2.02: Domain d1we5e1: 1we5 E:666-772

Lineage for d1we5e1 (1we5 E:666-772)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family)

5. Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)

6. Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)

7. Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
   Uniprot P31434

8. Domain d1we5e1: 1we5 E:666-772 [120957]
   Other proteins in same PDB: d1we5a2, d1we5a3, d1we5a4, d1we5b2, d1we5b3, d1we5b4, d1we5c2, d1we5c3, d1we5c4, d1we5d2, d1we5d3, d1we5d4, d1we5e2, d1we5e3, d1we5e4, d1we5f2, d1we5f3, d1we5f4
   automatically matched to 2F2H A:666-773
   complexed with mes

Details for d1we5e1

PDB Entry: 1we5, 2.4 Å

PDB Description: crystal structure of alpha-xylosidase from escherichia coli

PDB Compounds: (E:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1we5e1:

Sequence; same for both SEQRES and ATOM records:

>d1we5e1 b.150.1.1 (E:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl

Timeline for d1we5e1:

• d1we5e1 first appeared in SCOP 1.73
  
• d1we5e1 appears in SCOPe 2.01
  
• d1we5e1 appears in SCOPe 2.03
  
• d1we5e1 appears in the current release, SCOPe 2.08