SCOPe 2.02: Domain d1w4oa_: 1w4o A:

Lineage for d1w4oa_ (1w4o A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (4 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (69 PDB entries)

8. Domain d1w4oa_: 1w4o A: [120633]
   automated match to d1a2wa_
   complexed with ua3

Details for d1w4oa_

PDB Entry: 1w4o, 1.6 Å

PDB Description: binding of nonnatural 3'-nucleotides to ribonuclease a

PDB Compounds: (A:) Pancreatic Ribonuclease A

SCOPe Domain Sequences for d1w4oa_:

Sequence; same for both SEQRES and ATOM records:

>d1w4oa_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d1w4oa_:

• d1w4oa_ first appeared in SCOP 1.73, called d1w4oa1
  
• d1w4oa_ appears in SCOPe 2.01
  
• d1w4oa_ appears in SCOPe 2.03
  
• d1w4oa_ appears in the current release, SCOPe 2.08