Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (4 species) |
Species Escherichia coli [TaxId:562] [111186] (9 PDB entries) Uniprot P02361 |
Domain d1vs5h1: 1vs5 H:3-129 [120489] Other proteins in same PDB: d1vs5b1, d1vs5c1, d1vs5c2, d1vs5d1, d1vs5e1, d1vs5e2, d1vs5f1, d1vs5g1, d1vs5i1, d1vs5j1, d1vs5k1, d1vs5l1, d1vs5m1, d1vs5n1, d1vs5o1, d1vs5p1, d1vs5q1, d1vs5r1, d1vs5s1, d1vs5t1, d1vs5u1 automatically matched to d1s03h_ complexed with ksg, mg |
PDB Entry: 1vs5 (more details), 3.46 Å
SCOP Domain Sequences for d1vs5h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vs5h1 d.140.1.1 (H:3-129) Ribosomal protein S8 {Escherichia coli [TaxId: 562]} qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg eiicyva
Timeline for d1vs5h1: