Lineage for d1vqmi1 (1vqm I:71-140)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1723435Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1723436Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1723437Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1723485Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
    Uniprot P14122 67-136
  8. 1723491Domain d1vqmi1: 1vqm I:71-140 [120312]
    Other proteins in same PDB: d1vqm11, d1vqm21, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmg1, d1vqmh1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmv1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
    automatically matched to d1s72i_
    protein/RNA complex; complexed with cd, cl, k, mg, na, po2, sr

Details for d1vqmi1

PDB Entry: 1vqm (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d1vqmi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqmi1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie

SCOPe Domain Coordinates for d1vqmi1:

Click to download the PDB-style file with coordinates for d1vqmi1.
(The format of our PDB-style files is described here.)

Timeline for d1vqmi1: