Lineage for d1u4sa2 (1u4s A:164-328)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1225248Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1225249Superfamily d.162.1: LDH C-terminal domain-like [56327] (2 families) (S)
  5. 1225250Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (4 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
  6. 1225257Protein Lactate dehydrogenase [56339] (15 species)
  7. 1225312Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [56343] (15 PDB entries)
  8. 1225324Domain d1u4sa2: 1u4s A:164-328 [119530]
    Other proteins in same PDB: d1u4sa1
    automatically matched to d1oc4a2
    complexed with bih

Details for d1u4sa2

PDB Entry: 1u4s (more details), 2 Å

PDB Description: Plasmodium falciparum lactate dehydrogenase complexed with 2,6-naphthalenedisulphonic acid
PDB Compounds: (A:) l-lactate dehydrogenase

SCOPe Domain Sequences for d1u4sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1u4sa2 d.162.1.1 (A:164-328) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ggvldtsrlkyyisqklnvcprdvnahivgahgnkmvllkryitvggiplqefinnklis
daeleaifdrtvntaleivnlhaspyvapaaaiiemaesylkdlkkvlicstllegqygh
sdifggtpvvlgangveqvielqlnseekakfdeaiaetkrmkal

SCOPe Domain Coordinates for d1u4sa2:

Click to download the PDB-style file with coordinates for d1u4sa2.
(The format of our PDB-style files is described here.)

Timeline for d1u4sa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1u4sa1