Lineage for d1twoa_ (1two A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1997935Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 1997936Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 1997937Protein Moth pheromone-binding protein, PBP [47569] (2 species)
  7. 1997938Species Polyphemus moth (Antheraea polyphemus) [TaxId:7120] [101187] (3 PDB entries)
  8. 1997941Domain d1twoa_: 1two A: [119368]
    automated match to d2jpoa1

Details for d1twoa_

PDB Entry: 1two (more details)

PDB Description: nmr structure of the pheromone binding protein from antheraea polyphemus at acidic ph
PDB Compounds: (A:) pheromone-binding protein

SCOPe Domain Sequences for d1twoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twoa_ a.39.2.1 (A:) Moth pheromone-binding protein, PBP {Polyphemus moth (Antheraea polyphemus) [TaxId: 7120]}
speimknlsnnfgkamdqckdelslpdsvvadlynfwkddyvmtdrlagcainclatkld
vvdpdgnlhhgnakdfamkhgadetmaqqlvdiihgceksappnddkcmktidvamcfkk
eihklnwvpnmdlvigevlaev

SCOPe Domain Coordinates for d1twoa_:

Click to download the PDB-style file with coordinates for d1twoa_.
(The format of our PDB-style files is described here.)

Timeline for d1twoa_: