Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species) |
Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (92 PDB entries) Uniprot P01892 25-298 |
Domain d1tvba2: 1tvb A:1-181 [119349] Other proteins in same PDB: d1tvba1, d1tvbb_, d1tvbd1, d1tvbe_ automatically matched to d1akja2 complexed with gol |
PDB Entry: 1tvb (more details), 1.8 Å
SCOPe Domain Sequences for d1tvba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tvba2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]} gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq r
Timeline for d1tvba2:
View in 3D Domains from other chains: (mouse over for more information) d1tvbb_, d1tvbd1, d1tvbd2, d1tvbe_ |